ghk cu injection price GHK-Cu 50mg Copper Peptide, Packaging Type: Vial at ₹ 6500/box in Surat GHK Cu 50mg Copper Peptide

Consider implementing standardized documentation templates within your EHR to facilitate accurate code capture by AI scribes

Add $120.01 more to save 8% off For In Vitro Research Use Only Not for Human or Veterinary Use Intended Use: This compound is intended strictly for in vitro laboratory research

10.1080/00207450802338721 Int

Synonyms : NN0174-0833, AM833, EXA10092 Product Specifications CAS Number : 1415456993 Peptide Sequence : XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP Molecular Weight : 4409 g/mol Chemical Formula : CHNOS Purity : Typically supplied at 98% purity by HPLC

01/03/2026 Authored by: Sergey Terushkin, MD, FACS, FASMBS, DABOM, DABS-FPMBS Key Takeaways : Not Strictly Contraindicated: There is no direct chemical reaction between Tirzepatide and alcohol that would make it immediately toxic, but caution is strongly advised